Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Nails
51 product(s) found for "Nails"
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$13.00
Units in Stock: 18
$13.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$15.00
Units in Stock: 44
$15.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$14.00
Units in Stock: 16
$14.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$15.00
Units in Stock: 0
$15.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$12.00
Units in Stock: 34
$12.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$13.00
Units in Stock: 16
$13.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$15.00
Units in Stock: 77
$15.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$12.00
Units in Stock: 2
$12.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$13.00
Units in Stock: 29
$13.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$15.00
Units in Stock: 23
$15.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$15.00
Units in Stock: 25
$15.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$15.00
Units in Stock: 13
$15.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i