Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Candles
64 product(s) found for "Candles"
Aeropostale 14.5 oz Soy Wax ..
Candles
Aeropostale 14.5 oz Soy Wax ..
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
$11.00
Units in Stock: 16
$11.00
Details
Add To Cart
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
Aeropostale 14.5 oz Soy Wax ..
Candles
Aeropostale 14.5 oz Soy Wax ..
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
$11.00
Units in Stock: 42
$11.00
Details
Add To Cart
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
Aeropostale 14.5 oz Soy Wax ..
Candles
Aeropostale 14.5 oz Soy Wax ..
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
$11.00
Units in Stock: 11
$11.00
Details
Add To Cart
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
Aeropostale 14.5 oz Soy Wax ..
Candles
Aeropostale 14.5 oz Soy Wax ..
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
$11.00
Units in Stock: 15
$11.00
Details
Add To Cart
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
Aeropostale 14.5 oz Soy Wax ..
Candles
Aeropostale 14.5 oz Soy Wax ..
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
$11.00
Units in Stock: 8
$11.00
Details
Add To Cart
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
Aeropostale 14.5 oz Soy Wax ..
Candles
Aeropostale 14.5 oz Soy Wax ..
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
$11.00
Units in Stock: 21
$11.00
Details
Add To Cart
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
Aeropostale 14.5 oz Soy Wax ..
Candles
Aeropostale 14.5 oz Soy Wax ..
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
$11.00
Units in Stock: 8
$11.00
Details
Add To Cart
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
Aeropostale 14.5 oz Soy Wax ..
Candles
Aeropostale 14.5 oz Soy Wax ..
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
$11.00
Units in Stock: 4
$11.00
Details
Add To Cart
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
Aeropostale 14.5 oz Soy Wax ..
Candles
Aeropostale 14.5 oz Soy Wax ..
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
$11.00
Units in Stock: 26
$11.00
Details
Add To Cart
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
Aeropostale 14.5 oz Soy Wax ..
Candles
Aeropostale 14.5 oz Soy Wax ..
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
$11.00
Units in Stock: 15
$11.00
Details
Add To Cart
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
Aeropostale 14.5 oz Soy Wax ..
Candles
Aeropostale 14.5 oz Soy Wax ..
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
$11.00
Units in Stock: 53
$11.00
Details
Add To Cart
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
Aeropostale 14.5 oz Soy Wax ..
Candles
Aeropostale 14.5 oz Soy Wax ..
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
$11.00
Units in Stock: 46
$11.00
Details
Add To Cart
Top Notes: mango, papapya, pomelo, sea salt, blooming rose,Middle Notes: water lily, jasmine petals, red currant,Base Notes: soft woods, white musks
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i