Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Bath & Body
Sub-Categories
NailsFace CareShampooMoisturizersLip CareEye CareCleansers
1000 product(s) found for "Bath & Body"
Clinique Stay-Matte by Clini..
Face Care
Clinique Stay-Matte by Clini..
Clinique Stay Matte Oil Free Makeup, Lightweight, long-wearing foundation controls oil, leaves a matte finish.Tested for streaking and fading at 88 F with a constant 80% humidity, all to prove Stay-Matte...
$23.00
Units in Stock: 0
$23.00
Details
Add To Cart
Clinique Stay Matte Oil Free Makeup, Lightweight, long-wearing foundation controls oil, leaves a matte finish.Tested for streaking and fading at 88 F with a constant 80% humidity, all to prove Stay-Matte...
Clinique Stay-Matte by Clini..
Face Care
Clinique Stay-Matte by Clini..
Clinique Stay Matte Oil Free Makeup, Lightweight, long-wearing foundation controls oil, leaves a matte finish.Tested for streaking and fading at 88 F with a constant 80% humidity, all to prove Stay-Matte...
$23.00
Units in Stock: 0
$23.00
Details
Add To Cart
Clinique Stay Matte Oil Free Makeup, Lightweight, long-wearing foundation controls oil, leaves a matte finish.Tested for streaking and fading at 88 F with a constant 80% humidity, all to prove Stay-Matte...
Clinique Stay-Matte by Clini..
Face Care
Clinique Stay-Matte by Clini..
Clinique Stay Matte Oil Free Makeup, Lightweight, long-wearing foundation controls oil, leaves a matte finish.Tested for streaking and fading at 88 F with a constant 80% humidity, all to prove Stay-Matte...
$23.00
Units in Stock: 0
$23.00
Details
Add To Cart
Clinique Stay Matte Oil Free Makeup, Lightweight, long-wearing foundation controls oil, leaves a matte finish.Tested for streaking and fading at 88 F with a constant 80% humidity, all to prove Stay-Matte...
Clinique Stay-Matte by Clini..
Face Care
Clinique Stay-Matte by Clini..
Clinique Stay Matte Oil Free Makeup, Lightweight, long-wearing foundation controls oil, leaves a matte finish.Tested for streaking and fading at 88 F with a constant 80% humidity, all to prove Stay-Matte...
$19.00
Units in Stock: 1
$19.00
Details
Add To Cart
Clinique Stay Matte Oil Free Makeup, Lightweight, long-wearing foundation controls oil, leaves a matte finish.Tested for streaking and fading at 88 F with a constant 80% humidity, all to prove Stay-Matte...
Clinique Superbalanced Makeu..
Face Care
Clinique Superbalanced Makeu..
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
$15.00
Units in Stock: 0
$15.00
Details
Add To Cart
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
Clinique Superbalanced Makeu..
Face Care
Clinique Superbalanced Makeu..
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
$19.00
Units in Stock: 0
$19.00
Details
Add To Cart
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
Clinique Superbalanced Makeu..
Face Care
Clinique Superbalanced Makeu..
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
$19.00
Units in Stock: 0
$19.00
Details
Add To Cart
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
Clinique Superbalanced Makeu..
Face Care
Clinique Superbalanced Makeu..
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
$19.00
Units in Stock: 0
$19.00
Details
Add To Cart
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
Clinique Superbalanced Makeu..
Face Care
Clinique Superbalanced Makeu..
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
$19.00
Units in Stock: 0
$19.00
Details
Add To Cart
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
Clinique Superbalanced Makeu..
Face Care
Clinique Superbalanced Makeu..
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
$19.00
Units in Stock: 0
$19.00
Details
Add To Cart
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
Clinique Superbalanced Makeu..
Face Care
Clinique Superbalanced Makeu..
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
$19.00
Units in Stock: 0
$19.00
Details
Add To Cart
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
Clinique Superbalanced Makeu..
Face Care
Clinique Superbalanced Makeu..
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
$19.00
Units in Stock: 0
$19.00
Details
Add To Cart
Before: 02 Fair. Now: CN 20 Fair.The smart makeup. Liquid foundation with adjustable, oil-free coverage.Provides moisture and absorbs oil when and where needed. Free of synthetic colors, denatured alcohol,...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i