Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Bath & Body
Sub-Categories
NailsFace CareShampooMoisturizersLip CareEye CareCleansers
1000 product(s) found for "Bath & Body"
Old Spice Classic by Old Spi..
Bath & Body
Old Spice Classic by Old Spi..
This masculine scent posesses a blend of: citrus, flowers and vanilla, a rich, classic scent.
$9.00
Units in Stock: 0
$9.00
Details
Add To Cart
This masculine scent posesses a blend of: citrus, flowers and vanilla, a rich, classic scent.
Ombre Rose by Jean-Charles B..
Bath & Body
Ombre Rose by Jean-Charles B..
Delicately perfumed to leave skin silky and scented for hours, Ombre Rose Body Lotion. Ombre Rose was created by high-fashion designer Jean-Charles Brosseau. The fragrance charms with its very first powdery,...
$16.00
Units in Stock: 2
$16.00
Details
Add To Cart
Delicately perfumed to leave skin silky and scented for hours, Ombre Rose Body Lotion. Ombre Rose was created by high-fashion designer Jean-Charles Brosseau. The fragrance charms with its very first powdery,...
Ombre Rose by Jean-Charles B..
Bath & Body
Ombre Rose by Jean-Charles B..
Ombre Rose L'Original by Jean Charles Brosseau is a Floral fragrance for women. Ombre Rose L'Original was launched in 1981. Top notes are aldehydes, peach, brazilian rosewood and geranium; middle notes...
$24.00
Units in Stock: 6
$24.00
Details
Add To Cart
Ombre Rose L'Original by Jean Charles Brosseau is a Floral fragrance for women. Ombre Rose L'Original was launched in 1981. Top notes are aldehydes, peach, brazilian rosewood and geranium; middle notes...
Onika by Nicki Minaj, 8 oz B..
Bath & Body
Onika by Nicki Minaj, 8 oz B..
Onika Tanya Maraj, known as Nicki Minaj, American rapper and pop star, launched a new fragrance called Onika. Nicki announced that Onika smells like angels in the garden of perfection. Onika is wearing...
$7.00
Units in Stock: 27
$7.00
Details
Add To Cart
Onika Tanya Maraj, known as Nicki Minaj, American rapper and pop star, launched a new fragrance called Onika. Nicki announced that Onika smells like angels in the garden of perfection. Onika is wearing...
OPI Bond Aid by OPI, 1 oz PH..
Moisturizers
OPI Bond Aid by OPI, 1 oz PH..
OPI BAND-AID is the best selling pH balanced bonder used for all nail enhancements. The formula used in this product will create a longer-lasting bond for applying nail lacquer to natural nails and also...
$5.00
Units in Stock: 300
$5.00
Details
Add To Cart
OPI BAND-AID is the best selling pH balanced bonder used for all nail enhancements. The formula used in this product will create a longer-lasting bond for applying nail lacquer to natural nails and also...
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$13.00
Units in Stock: 18
$13.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$14.00
Units in Stock: 16
$14.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$15.00
Units in Stock: 0
$15.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$13.00
Units in Stock: 16
$13.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$15.00
Units in Stock: 77
$15.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$12.00
Units in Stock: 2
$12.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
OPI Gel Nail Polish by OPI, ..
Nails
OPI Gel Nail Polish by OPI, ..
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
$13.00
Units in Stock: 29
$13.00
Details
Add To Cart
OPI GelColor is gel nail polish with a thin, brush-on formula designed for high performance and a glossier finish compared to a regualr nail polish. Additional UPCs: 4064665116793
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i