Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Lip Care
155 product(s) found for "Lip Care"
MAC Matte Lipstick by MAC, ...
Lip Care
MAC Matte Lipstick by MAC, ...
MAC Lipstick - the iconic product that made MAC famous. This creamy rich formula features high colour payoff in a no-shine matte finish.
$18.00
Units in Stock: 0
$18.00
Details
Add To Cart
MAC Lipstick - the iconic product that made MAC famous. This creamy rich formula features high colour payoff in a no-shine matte finish.
MAC Powder Kiss Lipstick by ..
Lip Care
MAC Powder Kiss Lipstick by ..
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
$14.00
Units in Stock: 2
$14.00
Details
Add To Cart
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
MAC Powder Kiss Lipstick by ..
Lip Care
MAC Powder Kiss Lipstick by ..
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
$15.00
Units in Stock: 5
$15.00
Details
Add To Cart
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
MAC Powder Kiss Lipstick by ..
Lip Care
MAC Powder Kiss Lipstick by ..
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
$16.00
Units in Stock: 0
$16.00
Details
Add To Cart
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
MAC Powder Kiss Lipstick by ..
Lip Care
MAC Powder Kiss Lipstick by ..
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
$16.00
Units in Stock: 12
$16.00
Details
Add To Cart
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
MAC Powder Kiss Lipstick by ..
Lip Care
MAC Powder Kiss Lipstick by ..
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
$16.00
Units in Stock: 28
$16.00
Details
Add To Cart
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
MAC Powder Kiss Lipstick by ..
Lip Care
MAC Powder Kiss Lipstick by ..
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
$15.00
Units in Stock: 13
$15.00
Details
Add To Cart
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
MAC Powder Kiss Lipstick by ..
Lip Care
MAC Powder Kiss Lipstick by ..
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
$18.00
Units in Stock: 0
$18.00
Details
Add To Cart
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
MAC Powder Kiss Lipstick by ..
Lip Care
MAC Powder Kiss Lipstick by ..
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
$14.00
Units in Stock: 0
$14.00
Details
Add To Cart
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
MAC Powder Kiss Lipstick by ..
Lip Care
MAC Powder Kiss Lipstick by ..
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
$14.00
Units in Stock: 7
$14.00
Details
Add To Cart
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
MAC Powder Kiss Lipstick by ..
Lip Care
MAC Powder Kiss Lipstick by ..
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
$14.00
Units in Stock: 0
$14.00
Details
Add To Cart
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
MAC Powder Kiss Lipstick by ..
Lip Care
MAC Powder Kiss Lipstick by ..
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
$16.00
Units in Stock: 22
$16.00
Details
Add To Cart
Matte, totally reinvented. Delivering a blur of soft-focus colour, this weightless moisture-matte lipstick was developed to replicate a backstage technique: blending out edges of matte lipstick for a hazy...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i