Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Lip Care
155 product(s) found for "Lip Care"
Clinique Chubby Stick by Cli..
Lip Care
Clinique Chubby Stick by Cli..
Get vibrant, nourishing color with Clinique's Crayola Chubby Sticks loaded with mango and shea butters so that lips feel comfortably soft and smooth.
$14.00
Units in Stock: 0
$14.00
Details
Add To Cart
Get vibrant, nourishing color with Clinique's Crayola Chubby Sticks loaded with mango and shea butters so that lips feel comfortably soft and smooth.
Clinique Chubby Stick by Cli..
Lip Care
Clinique Chubby Stick by Cli..
Get vibrant, nourishing color with Clinique's Crayola Chubby Sticks loaded with mango and shea butters so that lips feel comfortably soft and smooth.
$14.00
Units in Stock: 0
$14.00
Details
Add To Cart
Get vibrant, nourishing color with Clinique's Crayola Chubby Sticks loaded with mango and shea butters so that lips feel comfortably soft and smooth.
Clinique Dramatically Differ..
Lip Care
Clinique Dramatically Differ..
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
$14.00
Units in Stock: 0
$14.00
Details
Add To Cart
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
Clinique Dramatically Differ..
Lip Care
Clinique Dramatically Differ..
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
$15.00
Units in Stock: 0
$15.00
Details
Add To Cart
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
Clinique Dramatically Differ..
Lip Care
Clinique Dramatically Differ..
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
$8.00
Units in Stock: 0
$8.00
Details
Add To Cart
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
Clinique Dramatically Differ..
Lip Care
Clinique Dramatically Differ..
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
$14.00
Units in Stock: 0
$14.00
Details
Add To Cart
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
Clinique Dramatically Differ..
Lip Care
Clinique Dramatically Differ..
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
$14.00
Units in Stock: 0
$14.00
Details
Add To Cart
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
Clinique Dramatically Differ..
Lip Care
Clinique Dramatically Differ..
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
$14.00
Units in Stock: 0
$14.00
Details
Add To Cart
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
Clinique Dramatically Differ..
Lip Care
Clinique Dramatically Differ..
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
$11.00
Units in Stock: 0
$11.00
Details
Add To Cart
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
Clinique Dramatically Differ..
Lip Care
Clinique Dramatically Differ..
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
$14.00
Units in Stock: 0
$14.00
Details
Add To Cart
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
Clinique Dramatically Differ..
Lip Care
Clinique Dramatically Differ..
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
$14.00
Units in Stock: 0
$14.00
Details
Add To Cart
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
Clinique Dramatically Differ..
Lip Care
Clinique Dramatically Differ..
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
$14.00
Units in Stock: 0
$14.00
Details
Add To Cart
Dramatically Different Lipstick delivers more than just color. 3D pearl center core instantly sculpts and contours, providing an immediate appearance of a smoother pout. Over time, lip definition is improved....
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i