Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Lip Care
155 product(s) found for "Lip Care"
Eight Hour Cream Lip Protect..
Lip Care
Eight Hour Cream Lip Protect..
This all-weather treatment stick helps moisturize, soften and smooth your lips. Sheer Tint Sunscreen SPF 15.
$12.00
Units in Stock: 0
$12.00
Details
Add To Cart
This all-weather treatment stick helps moisturize, soften and smooth your lips. Sheer Tint Sunscreen SPF 15.
Eight Hour Cream Lip Protect..
Lip Care
Eight Hour Cream Lip Protect..
This all-weather treatment stick helps moisturize, soften and smooth your lips. Sheer Tint Sunscreen SPF 15.
$12.00
Units in Stock: 35
$12.00
Details
Add To Cart
This all-weather treatment stick helps moisturize, soften and smooth your lips. Sheer Tint Sunscreen SPF 15.
Estee Lauder, .12oz Pure Col..
Lip Care
Estee Lauder, .12oz Pure Col..
A vibrant yellow red with a warm undertone. Statement-making, lip-shaping color. Creme finish. Color with the power to transform your lips, your look, your attitude. Sculpts: Multi-faceted pigments wrap...
$22.00
Units in Stock: 0
$22.00
Details
Add To Cart
A vibrant yellow red with a warm undertone. Statement-making, lip-shaping color. Creme finish. Color with the power to transform your lips, your look, your attitude. Sculpts: Multi-faceted pigments wrap...
ILIA Balmy Gloss Tinted Lip ..
Lip Care
ILIA Balmy Gloss Tinted Lip ..
A cushiony - tinted lip oil packed with plumping Hyaluronic Acid and major moisturizing properties that leaves lips soft - smooth and anything but sticky.
$15.00
Units in Stock: 0
$15.00
Details
Add To Cart
A cushiony - tinted lip oil packed with plumping Hyaluronic Acid and major moisturizing properties that leaves lips soft - smooth and anything but sticky.
ILIA Balmy Gloss Tinted Lip ..
Lip Care
ILIA Balmy Gloss Tinted Lip ..
A cushiony - tinted lip oil packed with plumping Hyaluronic Acid and major moisturizing properties that leaves lips soft - smooth and anything but sticky.
$18.00
Units in Stock: 5
$18.00
Details
Add To Cart
A cushiony - tinted lip oil packed with plumping Hyaluronic Acid and major moisturizing properties that leaves lips soft - smooth and anything but sticky.
ILIA Balmy Gloss Tinted Lip ..
Lip Care
ILIA Balmy Gloss Tinted Lip ..
A cushiony - tinted lip oil packed with plumping Hyaluronic Acid and major moisturizing properties that leaves lips soft - smooth and anything but sticky.
$18.00
Units in Stock: 0
$18.00
Details
Add To Cart
A cushiony - tinted lip oil packed with plumping Hyaluronic Acid and major moisturizing properties that leaves lips soft - smooth and anything but sticky.
ILIA Balmy Gloss Tinted Lip ..
Lip Care
ILIA Balmy Gloss Tinted Lip ..
A cushiony - tinted lip oil packed with plumping Hyaluronic Acid and major moisturizing properties that leaves lips soft - smooth and anything but sticky.
$18.00
Units in Stock: 0
$18.00
Details
Add To Cart
A cushiony - tinted lip oil packed with plumping Hyaluronic Acid and major moisturizing properties that leaves lips soft - smooth and anything but sticky.
ILIA Balmy Gloss Tinted Lip ..
Lip Care
ILIA Balmy Gloss Tinted Lip ..
A cushiony - tinted lip oil packed with plumping Hyaluronic Acid and major moisturizing properties that leaves lips soft - smooth and anything but sticky.
$15.00
Units in Stock: 10
$15.00
Details
Add To Cart
A cushiony - tinted lip oil packed with plumping Hyaluronic Acid and major moisturizing properties that leaves lips soft - smooth and anything but sticky.
ILIA Balmy Gloss Tinted Lip ..
Lip Care
ILIA Balmy Gloss Tinted Lip ..
A cushiony - tinted lip oil packed with plumping Hyaluronic Acid and major moisturizing properties that leaves lips soft - smooth and anything but sticky.
$15.00
Units in Stock: 8
$15.00
Details
Add To Cart
A cushiony - tinted lip oil packed with plumping Hyaluronic Acid and major moisturizing properties that leaves lips soft - smooth and anything but sticky.
ILIA Balmy Tint Hydrating Li..
Lip Care
ILIA Balmy Tint Hydrating Li..
A clean, tinted lip balm with active levels of moisture-boosting ingredients and sheer color that builds with each swipe. The buttery, balmy formula slides on with a smooth, satisfying slip. ILIA Balmy...
$16.00
Units in Stock: 10
$16.00
Details
Add To Cart
A clean, tinted lip balm with active levels of moisture-boosting ingredients and sheer color that builds with each swipe. The buttery, balmy formula slides on with a smooth, satisfying slip. ILIA Balmy...
ILIA Balmy Tint Hydrating Li..
Lip Care
ILIA Balmy Tint Hydrating Li..
A clean, tinted lip balm with active levels of moisture-boosting ingredients and sheer color that builds with each swipe. The buttery, balmy formula slides on with a smooth, satisfying slip. ILIA Balmy...
$16.00
Units in Stock: 9
$16.00
Details
Add To Cart
A clean, tinted lip balm with active levels of moisture-boosting ingredients and sheer color that builds with each swipe. The buttery, balmy formula slides on with a smooth, satisfying slip. ILIA Balmy...
ILIA Balmy Tint Hydrating Li..
Lip Care
ILIA Balmy Tint Hydrating Li..
A clean, tinted lip balm with active levels of moisture-boosting ingredients and sheer color that builds with each swipe. The buttery, balmy formula slides on with a smooth, satisfying slip. ILIA Balmy...
$19.00
Units in Stock: 45
$19.00
Details
Add To Cart
A clean, tinted lip balm with active levels of moisture-boosting ingredients and sheer color that builds with each swipe. The buttery, balmy formula slides on with a smooth, satisfying slip. ILIA Balmy...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i