USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Notify me when product is back in stock
Angel by Thierry Mugler, 6.8 oz Perfuming Shower Gel for Women
Angel by Thierry Mugler, 6.8 oz Perfuming Shower Gel for Women
$41.00 inc. tax
Take the scent of Angel under the shower with Angel Perfuming Shower Gel. This fluid, blue-toned gel transforms into a fine, creamy mousse and invigorates the skin with its intense Angel fragrance. Angel Perfuming Shower Gel gently cleanses while respecting the skins pH. Discover the intoxicating, gourmand trail of Angel! A moment of relaxation and freshness thats deliciously Angel! Additional UPCs: 3439600056822
$41.00 inc. tax
Units in Stock
0
Add to Cart
Product Code: awang7psg
Brand: Thierry Mugler
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Details
Reviews

No Reviews Posted Yet - be the first!

write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i